extendsapls.site

Quick Summary

Online Status

Online

Server IP address resolved:YES
Http response code: 403
Response time: 0.92 sec.
Redirect Url:http://ww16.extendsapls.site/?sub1=20220206-2154-509b-84f9-7efab4718f91
Last Checked: 2022-02-06

extendsapls.site belongs to Trellian Pty. Limited

extendsapls.site registered under .site top-level domain.

The last verification results, performed on (Jan 7 06:02:06 2022 GMT) extendsapls.site show that extendsapls.site has an expired SSL certificate issued by Let's Encrypt (expired on Apr 7 06:02:05 2022 GMT). Click "Refresh" button for SSL Information at the Safety Information section.

The language been detected is en.

In accordance with Google Safe Browsing and Symantec extendsapls.site is pretty a safe domain.

Go [http] Go [https] archive.org Google Search Google Cache

extendsapls.site Related Information

Related Keywords

Http headers when vist http://extendsapls.site

HTTP/1.1 302 Found
Date: Sun, 06 Feb 2022 10:54:50 GMT
Server: Apache/2.4.25 (Debian)
Set-Cookie: __tad=1644144890.5462216; expires=Wed, 04-Feb-2032 10:54:50 GMT; Max-Age=315360000
Location: http://ww16.extendsapls.site/?sub1=20220206-2154-509b-84f9-7efab4718f91
Connection: close
Content-Type: text/html; charset=UTF-8

HTTP/1.1 403 Forbidden
Date: Sun, 06 Feb 2022 10:54:51 GMT
Content-Type: text/html
Content-Length: 552
Vary: Accept-Encoding
Server: NginX

extendsapls.site Safety Information

Overview

Last Updated: 08/22/2021

Unknown status.

We gather website safety and reputation data and compare it with available third-party sources so we calculate own safety and trustworthiness rate based on information that we get.

Norton Connect Safe

Last Updated: 04/01/2020

extendsapls.site is safe.

Norton ConnectSafe evaluates extendsapls.site for any unsafe and insecure content. The results are critical for families with young children.

Google Safe Search

Last Updated: 08/22/2021

Not yet checked.

SafeSearch is used as a parental control tool to filter out any inappropriate for your children search results on your devices: phones, tablets or personal computers.

Google Safe Browsing

Last Updated: 04/02/2020

extendsapls.site is safe.
Malware: not found.
Phishing: not detected.
Unwanted software: not found.
Harmfull applications: not found.

Google Safe Browsing notifies when websites are compromised by malicious actors. These protections work across Google products and provide a safer online experience.

Site Advisor

Last Updated: 04/01/2021

extendsapls.site is safe.

McAfee assesses extendsapls.site for a meaningful set of security threats. Featured dangers from annoying pop-ups to hidden Trojans, that can steal your identity, will be revealed. McAfee does not analyze extendsapls.site for mature or inappropriate content, only security checks are evaluated.

Web of Trust

Last Updated: 2022-02-06 17:51:20

extendsapls.site child safety is unknown.

The WOT calculates reputation of the extendsapls.site. This reputation system receives ratings from users and information from third-party sources, assesses the extendsapls.site for safety features and confirms, whether extendsapls.site is suitable for children.

SSL Information

Last Checked: 2022-02-06

Domain	hjav.guru
SSL Country	US
Issuer Organization	Let's Encrypt
Issuer	R3
Valid form	Jan 7 06:02:06 2022 GMT
Expiration	Apr 7 06:02:05 2022 GMT
Additional Domains	Additional Domains .ailianjiangjia.com .aptashchool.com .asians19.com .astronomicaltrends.com .atmosferterjadinyapelangi.com .augdjctf.com .aurranches.com .automahindra.com .automaintenancesyste.com .autorisationfairedusportm3deci.com .autotication.com .avakinavacoins.com .avengersinfinitywar-warmachinetoysinhamleys.com .avesendroide.com .ayarlanabilirduy.com .banksinarmad.com .barseera.com .bullionvalt.com .dennisau.org .documentinggreality.com .elegentquiz.com .elitedesignznd.com .extendsapls.site .failory.co .hetaiz.top .hjav.guru .huaweimobilewife.com .kissjay.com .konakevi.com .kristin-b.com .laabejitacuriosa.com .littleprettyprinters.com .misfitsmaket.com .misperceptionllc.com .mountainjeep.com .myrkcl.in .parroquiacorazondejesus.com .q3alive.net .realdeeplove.com .renewalspckg.com .riazpharma.com .signup.cam .sintmaarten.co .snowmaking.net .tangazetesi.co .tpbtpb.tel .writeforusnigeria.com .x1ycgyng.world .xfourm.club .youhaveto.be ailianjiangjia.com aptashchool.com asians19.com astronomicaltrends.com atmosferterjadinyapelangi.com augdjctf.com aurranches.com automahindra.com automaintenancesyste.com autorisationfairedusportm3deci.com autotication.com avakinavacoins.com avengersinfinitywar-warmachinetoysinhamleys.com avesendroide.com ayarlanabilirduy.com banksinarmad.com barseera.com bullionvalt.com dennisau.org documentinggreality.com elegentquiz.com elitedesignznd.com extendsapls.site failory.co hetaiz.top hjav.guru huaweimobilewife.com kissjay.com konakevi.com kristin-b.com laabejitacuriosa.com littleprettyprinters.com misfitsmaket.com misperceptionllc.com mountainjeep.com myrkcl.in parroquiacorazondejesus.com q3alive.net realdeeplove.com renewalspckg.com riazpharma.com signup.cam sintmaarten.co snowmaking.net tangazetesi.co tpbtpb.tel writeforusnigeria.com x1ycgyng.world xfourm.club youhaveto.be

extendsapls.site Server Information

Server Location 103.224.182.210

City: Beaumaris

Region: Victoria

Country: Australia

Longitude: 145.03894042969

Latitude: -37.982200622559

extendsapls.site Domain Name Information

WHOIS

Create Time: 2022-01-07

Exp Time: 2023-01-07

Registrar: Dynadot LLC

Domain Whois

Domain Name: EXTENDSAPLS.SITE
Registry Domain ID: D268292577-CNIC
Registrar WHOIS Server: whois.dynadot.com
Registrar URL: http://www.dynadot.com
Updated Date: 2022-01-12T22:56:39.0Z
Creation Date: 2022-01-07T02:11:58.0Z
Registry Expiry Date: 2023-01-07T23:59:59.0Z
Registrar: Dynadot LLC
Registrar IANA ID: 472
Domain Status: serverTransferProhibited https://icann.org/epp#serverTransferProhibited
Registrant State/Province: California
Registrant Country: US
Name Server: 170.NS1.ABOVE.COM
Name Server: 170.NS2.ABOVE.COM
DNSSEC: unsigned
Registrar Abuse Contact Email: [email protected]
Registrar Abuse Contact Phone: +1.6502620100
>>> Last update of WHOIS database: 2022-02-06T11:45:27.0Z <<<

DNS Records

Host	A Record	TTL
extendsapls.site.	103.224.182.210	3600

Host	NS Record	TTL
extendsapls.site.	ns1.above.com.	86400
extendsapls.site.	ns2.above.com.	86400

Host	MX Record	Priority	TTL
extendsapls.site.	park-mx.above.com.	10	3600

Host	TXT Record	TTL
extendsapls.site.	df67490d49f24b046be96d96a13e7022af781ed6	3600
extendsapls.site.	v=spf1 -all	3600

ns1.above.com.
TTL: 60
Email address: hostmaster.trellian.com.
Serial: 2022020601
Refresh: 10800
Retry: 3600
Expire: 604800
Minimum: 3600